Alois alzheimer – vše o zdraví

Hořící kamion a tři mrtví, včetně jednoho dítěte

Alzheimerovu chorobu poprvé popsal německý lékař Alois Alzheimer v roce 1907. V té době se považovala nemoc za vzácnou, zatímco v současné době trpí různou formou demence víc než sedm milionů obyvatel Evropy. Na otázky ohledně příčiny vzniku, průběhu a léčby odpovídá neuroložka Lucie Ondrová z Oblastní nemocnice Příbram.

Neuroložka příbramské nemocnice MUDr. Lucie Ondrová. | Foto: archiv nemocnice

Co je Alzheimerova choroba a jakou část těla zasahuje?Alzheimerova choroba je onemocnění nervové soustavy. Hlavním projevem je degradace všech psychických funkcí končící hlubokou demencí.

Jakou věkovou skupinu nejčastěji postihuje a hraje ve výskytu roli pohlaví?Alois alzheimer - Vše o zdravíVýskyt Alzheimerovy nemoci stoupá s věkem. Onemocní většinou lidé nad 65 let. Nejsou ale výjimkou ani mladší. Ve věku 65 let trpí touto nemocí každý dvacátý. Ve věku 85 let každý pátý. Co se týká pohlaví, o trochu více častěji jsou postiženy ženy.

Jaké jsou příčiny vzniku tohoto onemocnění?Alzheimerova nemoc se řadí mezi neurodegenerativní onemocnění. Dochází k postižení nervových buněk různými chorobnými procesy, v důsledku nichž zanikají. Určitý vliv může mít i genetika.

Má tato nemoc své jasné příznaky?Nemoc začíná pozvolna. Hlavním příznakem je syndrom demence. To znamená úbytek intelektových schopností oproti předchozí úrovni.

Nejdříve se projevuje ztrátou krátkodobé paměti, neschopností zařídit běžné věci. Poté se postupně mění chování, porucha paměti se prohlubuje. Pacienti jsou zmatení, nejsou schopni se sami o sebe postarat.

Mohou mít deprese, halucinace, bludy, poruchy spánku, příjmu potravy, může se objevit epilepsie.

Jak velkou roli hraje při odhalování choroby blízké okolí pacienta?Většina pacientů si svůj problém na začátku uvědomuje. V tuto chvíli je nejvhodnější přijít k lékaři.

Pokud již nemoc pokročí, nemocní již nemusí mít dostatečný náhled. Při vyšetřování je vhodná přítomnost blízké osoby pacienta pro podání objektivních informací.

V diagnostice je nejdůležitějším krokem včasně rozpoznat přítomný syndrom demence.

Jakým způsobem se nemoc diagnostikuje?Diagnostika začíná anamnézou a zhodnocením klinického stavu. Následuje vyšetření pomocí specifických testů (MMSE, test hodin), které odhalí a kvantifikují úroveň demence. Samozřejmě i tyto testy mají své limity. Dále CT nebo MR mozku, EEG. Popř. další laboratorní vyšetření krve a mozkomíšního moku. Cenné je i vyšetření klinickým neuropsychologem.

Lze Alzheimerovu nemoc léčit?Zatím neexistuje žádný lék či metoda, která by Alzheimerovu nemoc vyléčila. Pomocí léků můžeme u některých pacientů pouze zpomalit její průběh.

Tato nemoc je velmi těžko snesitelná jak pro pacienta, tak jeho blízké.

Existuje nějaká pomoc nebo centra, která dokáží pomoci a povzbudit pacienta a pečující rodinu?Pro osoby trpící demencí a pro jejich rodinné příslušníky zajišťuje Česká alzheimerovská společnost poradenství a svépomocné skupiny.

Pro pečující pořádá specializované kurzy. Je možnost odlehčovacích služeb. Existují denní stacionáře pro pacienty s Alzheimerovou nemocí, bohužel ty jsou ale placené. V Příbrami je zajišťuje Farní charita Příbram a Sanco Příbram.

Existuje účinná prevence a případně jaká?U osob aktivně žijících a s vyšším vzděláním je pravděpodobnost výskytu nemoci nižší. Proto je důležitá pravidelná fyzická aktivita, udržovat sociální kontakty a mentální kondici například četbou knih, luštěním křížovek.


  • Lékař odpovídá,
  • nemoc,
  • Alzheimerova choroba,
  • Oblastní nemocnice Příbram,
  • Evropa,
  • Příbram,
  • lékař,
  • léčba,
  • Alois Alzheimer,
  • rodina,
  • buňka

Volkswagen Golf servisní knížka, koupeno v CZ, v záruce Škoda Fabia servisní knížka, koupeno v CZ Mitsubishi Outlander nové vozidlo, první majitel, servisní knížka, bez SPZ, v záruce Hyundai i30 první majitel, servisní knížka, koupeno v CZ, nehavarované Subaru Forester první majitel, servisní knížka, koupeno v CZ, nehavarované, v záruce Škoda Octavia servisní knížka, koupeno v CZ, nehavarované Škoda Fabia servisní knížka, koupeno v D Škoda Fabia první majitel, servisní knížka, koupeno v A + PRODAT AUTO


Alzheimerova choroba: příčiny, příznaky, diagnostika a léčba

Alois alzheimer - Vše o zdraví

Alzheimerova choroba je velmi závažné neuredegenerativní onemocnění mozku, které postihuje především osoby starší 85 let. Projevuje se postupným vznikem demence, kterou trpí až ¼ starší populace. Jako první tuto nemoc popsal Alois Alzheimer v roce 1907.

Příčiny vzniku Alzheimerovy choroby nejsou doposud jasné. Přesto je znám mechanismus onemocnění. V mozku v okolí nervových vláken dochází k ukládání patologických proteinů, které způsobují rozpad neuronů (nervová buňka) a jejich spojů. Dochází také k úbytku acetylcholinu. Acetylcholin je tzv. neuromediátor, tedy látka, díky níž dochází k přenosu vzruchu. 

Dále jsou také známé rizikové faktory tohoto onemocnění. Primárně mezi ně patří věk. Nemocní mladší 60 let jsou vzácností, nad 65 let trpí touto nemocí již každý 20. člověk. Ženy jsou ohroženy více než muži. Důležité místo mají také genetické predispozice- mezi blízkými příbuznými je výskyt mnohem vyšší.

Nové studie se domnívají, že roli hraje také dosažené vzdělání. Kouření a dlouhodobé požívání většího množství alkoholu také zvyšuje riziko vzniku Alzheimerovy choroby. 

Až 2x větší riziko onemocnění je u pacientů, kteří v minulosti prodělali vážný úraz hlavy, který byl spojen s minimálně 15 minutovým bezvědomím.

Příznaky Alzheimerovy choroby

Alzheimerova choroba začíná velmi pozvolně a nenápadně. Mnoho počátečních příznaků se přisuzuje vyššímu věku nemocného. Typickým příkladem je neustálé hledání věcí a jejich následné nalezení na neobvyklých místech. 

Alzheimerova nemoc má několik stádií:

  • Lehká demence: Pacient má problémy s dorozumíváním, mezi slovy dělá dlouhé pauzy a často opakuje, co již řekl. Nemocný trpí poruchami paměti, zakládá věci a zapomíná. Často dochází k dezorientaci v čase a také k bloudění i známými místy. Celkově se mění osobnost- nemocný je vztahovačný a podezíraví, často trpí depresemi.
  • Střední stadium demence: Nemocný ztrácí soudnost a prohlubuje se změna osobnosti. Časem se objevuje neschopnost vykonávat běžné aktivity jako je nakupování a vaření, nemocný potřebuje pomoc s osobní hygienou a oblékáním. V této fázi onemocnění často dochází k toulání venku, nemocný je často spoře oděn a neorientován v prostoru. 
  • Těžká demence: Pacient odmítá přijímat potravu, sám si na jídlo nikdy nevzpomene. Nepoznává blízké osoby ani okolí, není schopen souvislé řeči a je naprosto dezorientován a zmaten. Nemocný není schopen chůze a je upoután na kolečkové křeslo. Dále tělesně i duševně chátrá, ubývá na váze, nakonec umírá.

Diagnostika Alzheimerovy choroby

Lékař provádí diagnostiku pomocí několika testů, které dohromady podají zprávu o stavu nemocného a stádiu nemoci.

Mezi hlavní testy patří tzv. mental test, který zjišťuje kognitivní vlastnosti, schopnost orientace v čase a zapamatování si základních věcí. Pacientovy jsou kladeny otázky, na které podle svých aktuálních schopností odpovídá. 

Dále se hojně používá tzv.test aktivity denního života, při němž je vyzpovídána rodina nebo blízké okolí pacienta. Lékař zjišťuje, zda je nemocný schopen vykonávat běžné denní aktivity.

Léčba Alzheimerovy nemoci

Úplná léčba Alzheimerovy nemoci není bohužel známá a nemocný na postupující demenci umírá.  Přesto se stále provádí experimentální studie zaměřené na možnosti léčby tohoto onemocnění. V raném stádiu nemoci lze zpomalit postup Alzheimerovy nemoci s využitím kognitiva, tj.

léků zlepšujících kognitivní funkce (myšlení, orientace, paměť), antidepresiva (léky proti depresi) a neuroleptika (léky na odstranění podráždění a agresivity). Lékaři se domnívají, že požívání malého množství alkoholu může předcházet vzniku demence.

Diskutuje se také nad protektivními účinky marihuany.


Obávaný Alzheimer: Jaké hry pomáhají v boji s demencí a trénují paměť? | Ž

Miliony lidí na celém světě trpí Alzheimerovou chorobou a demencí. Dodnes je v této oblasti spousta nezodpovězených otázek. Lék na její vyléčení totiž stále neexistuje. Odborníci se snaží zjistit nové informace a to i prostřednictvím mobilních her. Jak můžete demenci oddálit?

Alzheimerova nemoc narušuje část mozku a způsobuje pokles takzvaných kognitivních funkcí – tedy myšlení, paměti, úsudku. Nejčastější příčinou je právě demence.

Poprvé tuto nemoc veřejně popsal v roce 1907 německý lékař Alois Alzheimer.

V jeho stínu se nemocí zabýval ještě pražský psychiatr a neuropatolog židovského původu a německé národnosti Oskar Fischer, který v témže roce měl již 12 podrobně rozebraných případů s touto diagnózou. 

Tehdy se považovala podle České alzheimerovské společnosti za vzácnou, dnes se nějaká forma demence vyskytuje u více než sedmi miliónů obyvatel Evropy.

Alzheimer straší všechny: Koho čeká a kdo mu unikne?

Zajímavé:  Ercefuryl - vše o zdraví

Nemoc začíná pozvolna a celkem nenápadně. Nejprve se zhoršuje krátkodobá paměť. Člověk se například není schopen postarat o některé věci v domácnosti. Rychlost postupu nemoci je zcela individuální. Postupně se při ní zhoršují vyjadřovací schopnosti a objevuje se zmatenost. V posledním stádiu už je pacient zcela závislý na druhých.

Mobilní hrou proti demenci

Ke zpomalení nástupu nežádoucích účinků slouží dostupné léky. Medicína na vyléčení Alzheimerovy choroby ale stále neexistuje. Nové informace k výzkumu snad přinese třeba i nová mobilní hra z dílny T-Mobile Sea Hero. Během čtyř minut hraní této hry totiž poskytnete vědcům pro výzkum vzniku Alzheimerovy choroby tolik dat, jako byste podstoupili deseti hodinové testování v laboratoři. 

„Hra Sea Hero je skutečně unikátní a vědecky hodnotná. Lidé se mohou bavit jejím hraním, zároveň tím vědcům poskytnou cenné informace, které by jinak sbírali až desítky let,“ říká odborný garant projektu v České republice Jakub Hort z Neurologické kliniky Motol.

O čem hra je?

Hráč hry se stává mořeplavcem, který brázdí vody moří a oceánů a fotí jejich obyvatele. Při tom uplatní zejména svůj postřeh a smysl pro orientaci. Právě zhoršení schopnosti prostorové orientace je jedním z průvodních jevů Alzheimerovy choroby, která je nejčastější příčinou demence.

Hraním hry lidé vědcům pomohou tomuto procesu lépe porozumět a rozlišit, kdy je zhoršení schopnosti orientace přirozeným důsledkem stárnutí a kdy už symptomem nemoci. Na základě toho pak bude možné vyvinout nové a mnohem přesnější diagnostické testy na demenci a pokročit v její léčbě.

Mobilní hra, ve které může každý pomoci vědcům v boji proti demenci.

Veškerá data zaznamenaná během hry jsou anonymizována a automaticky odesílána na zabezpečený server Deutsche Telekomu. Hráči nemusí zadávat žádné osobní údaje, pouze – pokud budou chtít zvýšit vědeckou hodnotu dat – mohou uvést informace o svém pohlaví, věku a zemi, v níž žijí.


Alzheimerova choroba: Co se děje s nemocným

Neurodegenerativní onemocnění mozku, při kterém dochází k postupné demenci, jako první popsali Oskar Fischer a Alois Alzheimer. V současné době není známa příčina jeho vzniku. Díky neuropatologickým nálezům však víme, jak nemoc probíhá.

Nástup choroby může být velmi pozvolný a jeho diagnostika je obtížná. Změny v mozku postupně způsobí rozpad nervových vláken a nervových buněk. Alzheimerovou chorobou se mění také látková činnost mozku.

6 z 10 případů demence způsobuje Alzheimer

Demenci může způsobit řada příčin. Nejčastěji ji má na svědomí právě Alzheimerova choroba. Některé z demencí je možno vyléčit, ale je důležité jejich včasné rozpoznání. Příčiny jejího vzniku však stále neznáme.

Hledají se společné genetické dispozice, intenzivně jsou zkoumány látky, které slouží k přenosu informací mezi nervovými buňkami. Dalšími oblastmi zájmu výzkumu jsou látky, vznikající při látkové přeměně v neuronech a současně ohrožující jejich život (zkracují jejich přežívání).

Věda se snaží zkoumat i vliv jiných faktorů, jako je role diety, pohybu, vlivu životního prostředí či geografických rozdílů.

Prevencí jakékoli demence a stárnutí mozku je cvičení. Abychom donutili mozek pracovat, nemusíme denně vzpírat činky. Jsou to křížovky, čtení, hraní karet, šachy a jakákoli práce s novými informacemi, vymýšlení nových postupů a strategií. Tyto aktivity mozek přinutí budovat si nové spoje mezi nervovými buňkami.

Čím hustší tato síť bude, tím déle začnou odumírat. Pokud mozek napadne Alzheimerova choroba a nervové buňky se začnou rozpadat, pak hodně záleží na tom, v jaké kondici byl mozek před nemocí. Proto také samotné propuknutí nemoci může trvat deset let, nebo třeba jen rok.

V podstatě platí, že čím vytrénovanější mozek byl v začátku, tím déle zůstane pacient soběstačný.

  • • Paměť se znatelně zhoršuje – v začátcích si ještě za chvíli vzpomenete, později se vám informace ztrácí definitivně.
  • • Roztržitost – zapnutá žehlička zapomenutá na stole, puštěná voda do vany, věci se ocitají na zcela nelogických místech – klíče v lednici, prádlo v troubě…
  • • Problémy s vyjadřováním – ztráta slovní zásoby, později zcela nelogický projev.
  • • Ztráta orientace – najednou nevíte, kde odbočit cestou na chalupu, ale také nedokážete rychle odečíst z ciferníku, kolik je vlastně hodin.
  • • Často a zásadně se mění nálady – pacient může ze smíchu přejít v hlasitý pláč, hněv, a to bez důvodu.

Pro nemocného s Alzheimerovou chorobou je často obtížné se dorozumět a být pochopen. K projevům Alzheimerovy nemoci patří i to, že nemocní jednají a chovají se takovým způsobem, který nás může znechutit nebo rozčílit. Uvědomte si, že to je důsledek nemoci a ne záměr. Naučte se s takovými obtížnými situacemi vyrovnat.

Čtěte také: Vysoký krevní tlak aneb Hrozba, která nebolí

Nemocní mají často potíže porozumět smyslu řečeného, ale jsou velmi citliví na to, jak se co říká. Snažte se vždy komunikovat vlídným a klidným tónem. Způsob komunikace volte oznamovací, ne tázací.

  Například místo abyste se ptali: „Chceš se jít vykoupat?“ oznamte: „Koupel máš připravenou, tady je ručník“. Rozptylujte pozornost nemocného. Nemocný chce jít například sám ven.

Místo, abyste řekli: „Kam chceš teď jít? Nemůžeš odejít sám,“ řekněte: „Než odejdeš, pojď mi tady s tím na chvilku pomoci“. Pacientova pozornost se zaměří na něco jiného a brzy zapomene na to, co chtěl původně dělat.

Vyhýbejte se diskusím o realitě. Nemocný si často realitu neuvědomuje a není schopen rozlišovat minulost a přítomnost. Může dokonce zapomenout, kdo jste. To je samozřejmě velmi nepříjemné, přesto netrvejte na své verzi reality, vznikl by tak ještě větší stres. Místo, abyste řekli: „Tatínkovi nemůžeš zavolat,“ řekněte: „On teď určitě není doma. Zavoláme mu později.“ 

Plánujte nemocnému každodenní činnost

Pacienti s Alzheimerovou chorobou se často nudí. Rádi by něco dělali, ale nevědí co a jak. Proto je dobré připravit jim na každý den nějakou činnost. Úkoly musejí být jednoduché. Vhodné je, když se činnosti opakují.

Pracujte spolu s nemocným a obtížnější část úkolů udělejte případně sami (například při pečení koláče sami obstarejte vážení nebo odměřování surovin). Dbejte na to, abyste se vy i nemocný udržovali v co nejlepší fyzické kondici.

Výborným pohybem je procházka v přírodě. Cvičení zmírňuje neklid a zlepšuje spánek.

   RYCHLÝ TEST!    Najděte v následujícím řádku šest ženských jmen. Zdravý mozek si s tím lehce poradí.  ERIRENAMEOPROMANASDČOMARCELAQPISHRENATAKSVMIVANASTENZORAHDOEM    
  1. Zajistěte nemocnému bezpečí
  2. • zabraňte nemocnému v řízení auta
  3. • dbejte na dodržování užívání léků
  4. • zajistěte, aby nemocný neměl přístup k důležitým dokumentům a k cennostem, k nebezpečným chemikáliím, čisticím prostředkům a lékům
  5. • dbejte na pravidelné stravování a pitný režim
  6. • zabezpečte ostré hrany nábytku, vratké židle, zajistěte dostatečné osvětlení, zvyšte bezpečnost v koupelně
  7. • informujte se o projektu Bezpečný návrat, který umožňuje nemocným nosit náramek s telefonním číslem, pokud nemocný zabloudí, operátoři pomohou s cestou domů
  8. Petra Lichnovská 
  9. Alphega lékárnice, Frýdlant nad Ostravicí


LEXIKON ZDRAVÍ: Vše o Alzheimerově chorobě

Také občas zapomínáte? Netušíte, kam jste založili klíče od auta, nebo v supermarketu marně dolujete z hlavy, co jste si vlastně chtěli nakoupit. S touto formou potíží s pamětí se čas od času setkává každý.

Problém však nastává ve chvíli, když se tyto problémy objevují často a navíc se i zhoršují. Může totiž jít o počáteční příznaky demence, za kterou až v 60 % případů stojí Alzheimerova choroba.

Její příznaky mohou kromě zhoršení či výpadku paměti znamenat v konečném důsledku i úplnou změnu osobnosti nemocného člověka.

V dnešním Lexikonu zdraví se budeme zabývat touto nemocí jako takovou, ale i tím, jak rozpoznat její prvotní příznaky a jak je možné pokusit se jí předejít pomocí trénování naší mysli. Poradí vám v tom odbornice na slovo vzatá, certifikovaná trenérka paměti Dana Steinová. A jako vždy jsme nezapomněli ani pár dobrých bylinek a závěrečné slovo neurologa.

Až 7 milionů nemocných…Prameny uvádějí, že za 50 – 60 % případů demence stojí právě Alzheimerova choroba, kterou poprvé v roce 1907 popsal německý lékař Alois Alzheimer. Na počátku 20. století byla nemoc považována za vzácnou, v současnosti jí však jen v Evropě trpí až 7 milionů obyvatel.

Zajímavé:  Císařský řez - vše o zdraví

A co je to demence?

Obecně jde o narušení části mozku a zhoršování jeho funkcí, jako jsou paměť, myšlení, schopnost vyjadřování a plánování, schopnost rozpoznávání lidí a věcí. Rovněž dochází ke změně osobnosti postiženého. Alzheimerova choroba a demence ale neznamená nutně to samé. Kromě Alzheimera existují ještě další příčiny demence, jako například vaskulární demence, jinak také multiinfarktová nemoc, která může vzniknout po opakovaných infarktech. Dalšími důvody demence jsou například různé záněty mozku, encefalitidy, vrozená Huntingtonova choroba či Parkinsonova nemoc. V případě depresí u starších osob někdy vzniká pseudodemence. 

Alzheimerova choroba je neurodegenerativní onemocnění mozku, při němž dochází k zániku některých nervových buněk a následnému ubývání mozkové hmoty.

Zároveň dochází k ubývání acetylcholinu, což je látka zodpovědná za přenos informací mezi mozkovými buňkami. Mozkové funkce se pak zhoršují. Ač se tato choroba přičítá spíše stáří, onemocnět mohou i lidé ve středním věku.

Ve skupině pětašedesátníků jí trpí 2 až 3 % populace, mezi osmdesátníky je to už polovina. V ČR se počet nemocných odhaduje na více než 150 000.

Alzheimer Foto:  Pixabay

Příčiny: Nejsou dosud přesně známé, zřejmě ale jde o kombinaci vnitřních a vnějších faktorů. Svůj podíl mohou mít snížená imunita, nedostatek vitaminů, cukrovka, ischemická choroba srdeční, poruchy činnosti jater, žlučníku či ledvin. Je možné, že svou roli hrají např. užívání některých léků nebo alkohol. Rizikovou skupinou jsou spíše ženy, což souvisí jednak s jejich vyšším průměrným věkem dožití a pravděpodobně i s produkcí některých hormonů.

Formy onemocněníFamiliární: Objevuje se ve věku 40 – 50 let a pravděpodobně je dána geneticky.Sporadická: Nejčastěji se rozvíjí po sedmdesátce a tvoří až 90 % všech případů. Souvisí s opotřebením tkání a narušením nervových spojů.


Rané stadium: Zpočátku se choroba projevuje nenápadně, objevují se zapomínání, potíže s vyjadřováním, dezorientace v prostoru a čase, podezíravost, vztahovačnost. Nemocný popírá, že má s pamětí problém, obtížně se rozhoduje, ztrácí iniciativu a samostatnost při řešení potíží. Časté jsou agresivita, známky deprese a úzkosti, ztráta zájmu o okolní dění a koníčky, mění se osobnost, kdy se člověk stává sobecký a egocentrický.Střední stadium: Změny osobnosti se prohlubují, postižený ztrácí soudnost, není sebekritický, ale kritizuje své okolí, přestává být schopen vykonávat běžné aktivity (např. vaření, péči o domácnost, hygienu či oblékání). Zhoršuje se komunikace s okolím, časté jsou halucinace, podezíravost, zmatenost, bloudění na známých místech atd.Pozdní stadium: Příznaky se prohlubují a stupňují, častá je porucha příjmu potravy, totální výpadky paměti, kdy člověk nepoznává ani blízké osoby, nechápe okolní dění a zcela ztrácí soběstačnost. Dochází k omezení či úplné ztrátě pohyblivosti, poruše vylučování, neschopnosti souvislé řeči a komunikace, hubnutí a celkovému chátrání na těle i duchu.

Prevence: Zdravý životní styl, vyhnout se alkoholu a cigaretám, pravidelný pohyb, který stimuluje funkci centrálního nervového systému. Vhodná je rovněž intelektuální aktivita, a to už od mládí, neboť trénovaný mozek nemoci lépe odolává. Více o možnostech prevence se dozvíte na vedlejší straně.

Léčba: Nejprve je potřeba diagnostikovat, zda se skutečně jedná o Alzheimerovu chorobu. Diagnózu provádí odborný lékař, který musí znát jednak rodinnou anamnézu a také musí vyhodnotit změny kognitivních funkcí pacienta v posledních letech.

Pro diagnostiku se užívá série testů, jejichž cílem je vyloučit jinou příčinu potíží. Součástí je i laboratorní vyšetření. Chorobu vyléčit nelze, můžeme pouze mírnit její příznaky pomocí léků a zpomalit progresi onemocnění.

Nedílnou součástí léčby je pravidelný pohyb – dokud je toho pacient schopen, měl by se snažit chodit. Dále jsou možná i nejrůznější rehabilitační cvičení. 


Alois Alzheimer objevil nemoc, která tehdy nikoho nezajímala. Dnes jí trpí 7 milionů lidí

Když německý psychiatr Alois Alzheimer poprvé referoval o ‚podivně těžkém onemocnění mozkové kůry‘, nejevili kolegové o jeho objev větší zájem a hodnotili ho spíš jako kuriozitu. Nyní je Alzheimerovo jméno známé na celém světě.

Demencí neboli mozkovým onemocněním, které po něm bylo pojmenováno, nyní v Evropě trpí podle odhadů více než sedm milionů lidí, v České republice touto nemocí trpí 180 000 pacientů. Alzheimer se narodil 14.

června 1864, tedy přesně před 155 lety.

Podle dobových dokumentů tehdy na setkání psychiatrů v Tübingenu z roku 1906 žádný z kolegů nepoložil Alzheimerovi doplňující otázku, rychle se přešlo k jinému tématu a také regionální list Tübinger Chronik věnoval objevu v obsáhlé zprávě z kongresu jednu krátkou větu. Alzheimer se zklamán vrátil na psychiatrickou kliniku do Mnichova.

Tehdy dvaačtyřicetiletý psychiatr líčil případ své pacientky Auguste Deterové, která předtím zemřela ve věku 55 let ‚zcela dementní‘, jak to Alzheimer formuloval. Pitva ukázala, že v mozku zemřelé bylo mnoho bílkovinových usazenin a odumřelých nervových buněk.

‚Bláznivý lékař s mikroskopem‘, jak se Alzheimerovi říkalo, tak zjistil základní mechanismus nejtěžší a nejčastější formy stařecké demence: ukládání jednoho druhu bílkoviny v mozkové kůře vede k odumírání nervových buněk. Proč se bílkovina tak masivně usazuje, není zcela jasné dodnes.

Proto je také Alzheimerova nemoc stále neléčitelná a průběh lze pouze o několik měsíců až let zbrzdit. Nejznámější obětí nemoci byl zřejmě bývalý americký prezident Ronald Reagan.

Zásluhy českého rodáka

V roce 1907 publikoval popisy diagnóz a obrázky histologického vyšetření mozků 16 pacientů se senilní demencí pražské psychiatrické kliniky v Kateřinkách také německo-židovský lékař a rodák ze Slaného Oskar Fischer, který v roce 1942 zahynul v Malé pevnosti v Terezíně. Fischerovo dílo a jeho zásluhy na výzkumu Alzeimerovy nemoci byly plně doceněny až o desítky let později.

Bavorský rodák Alzheimer studoval na několika prestižních univerzitách a doktorát z medicíny získal na univerzitě ve Würzburgu. Zemřel 19. prosince 1915 v polské Vratislavi.


Alzheimerova choroba

Degenerativní změny na mozku u pacientů s Alzheimerovou chorobou

Alzheimerova choroba (AD z angl. Alzheimer's disease) je neurodegenerativní onemocnění mozku projevující se ztrátou nervových buněk v některých částech mozku. Jedná se o nejčastější typ demence – tzn. ztráty kognitivních schopností – u osob starších 65 let – k prvním příznakům patří poruchy paměti, postupně se přidává poškození kognitivních a intelektuálních, ale i fyzických schopností. Onemocnění popsal v roce 1906 německý lékař Alois Alzheimer.[1]

Onemocnění se projevuje celou řadou typických příznaků v oblasti paměti (rychlé zapomínání, opakování stejných otázek, ztrácení předmětů a jejich odkládání na nesprávná místa, pokřivení paměti), jazykových schopností (obtížné hledání správných slov, mezery v řeči, používání nesprávných slov či jednodušších slov pro složitější myšlenku), orientaci v prostoru (problém s nalezením cesty, ztrácení se), výkonných funkcích (nesprávná rozhodnutí, obtíže s plánováním relativně jednoduchých aktivit) a chování (apatie, deprese, úzkost, vznětlivost a bludy).[2]


Příčiny Alzheimerovy choroby jsou velmi komplikované a pravděpodobně i poměrně variabilní. U tzv. familiární Alzheimerovy choroby, která se objevuje v raném věku (často již před 60. rokem života), hrají velký význam genetické příčiny. Častější je ovšem tzv.

sporadická Alzheimerova choroba (85–90 % všech případů Alzheimerovy choroby), jejíž příznaky se poprvé objevují typicky mezi 60. a 70. rokem života.[3] Familiární Alzheimerova choroba je obvykle způsobena vrozenými mutacemi v některých důležitých genech, jako je APP, tau a presenilin.

[3] Prvotním příčinám sporadické Alzheimerovy choroby rozumí věda méně, roli ale hraje obecné opotřebení tkání (patologie lysozomů, dysfunkce mitochondrií, oxidativní stres či zánětlivé projevy[3]). Předpokládá se, že jak familiární, tak sporadická Alzheimerova choroba nakonec vedou k hromadění amyloidu beta (Aβ) v mozkové tkáni.

Aβ vzniká rozkladem amyloidového prekurzorového proteinu (APP) a u zdravých osob je jeho vznik v rovnováze s jeho rozkladem. Pokud tělo produkuje příliš amyloidu beta nebo není dostatečně rychle rozkládán a odstraňován, vznikají tzv. amyloidní plaky – oblasti mozku především v hipokampu a mozkové kůře, s velkou koncentrací akumulovaného amyloidu beta.

Dochází k poškození nervových synapsí a axonů, tedy důležitých mozkových struktur, jejichž narušení vede k širokému spektru neurologických projevů, jež jsou pro Alzheimerovu chorobu typické.[3]

Stádia nemoci

Rané stadium

Obtížné dorozumívání, zapomínání, zakládání věcí, podezíravost, vztahovačnost, popírání problémů a poruchy paměti, dezorientace v čase, bloudění na známých místech, obtížné rozhodování a bezradnost, ztráta iniciativy, známky deprese, úzkosti a agresivity, ztráta zájmu o koníčky, změna osobnosti – sobeckost a egocentričnost.

Zajímavé:  Cévy - vše o zdraví

Střední stadium

Poruchy soudnosti, nekritičnost, prohlubování změn osobnosti, neschopnost vykonávat běžné aktivity jako je vaření a nakupování, potřeba pomoci při vykonávání osobní hygieny a oblékání, obtížná komunikace, toulání, bloudění, poruchy chování, halucinace, podezírání, stavy zmatenosti.

Pozdní stadium

Poruchy příjmu potravy, nerozpoznání blízkých osob, nechápání okolního dění, ztráta schopnosti souvislé řeči, velké stavy zmatenosti, obtížná chůze, poruchy vylučování moči a stolice, úplná ztráta soběstačnosti, upoutání na invalidní vozík, tělesné i duševní chátrání, hubnutí, smrt.


PET obraz mozku pacienta s Alzheimerovou chorobou (patrné je utlumení činnosti v parietální (temenní) oblasti

Kritéria pro diagnózu Alzheimerovy choroby stanovují dva hlavní dokumenty – DSM-5 (Diagnostic and Statistical Manual of Mental Disorders, edice 5) a NIA-AA (National Institute on Aging—Alzheimer’s Association Criteria). Hodnotí se přítomnost demence, nedostatečnosti v alespoň dvou kognitivních oblastech, pozvolný nástup a progresívní zhoršování stavu a dále je nutné vyloučit další možné příčiny demence. Diagnózu je možné podpořit také biochemickým vyšetřením mozkomíšního moku (snížená hladina rozpustného amyloidu Aβ42 a zvýšená hladina proteinu tau) a mozkovými zobrazovacími metodami, zejména pozitronovou emisní tomografií (PET) a magnetickou rezonancí (MRI).[2]


V současné době neexistují dostatečné důkazy o jakékoliv preventivní technice, jež by jednoznačně spolehlivě zabránila nástupu Alzheimerovy choroby.

[4][5][6][7] Výsledky výzkumu v této oblasti jsou poměrně různorodé a protiřečí si. V některých studiích byl nalezen vztah mezi např.

skladbou stravování, kardiovaskulárními onemocněními, užíváním některých léčiv a intelektuální aktivitou dotyčného, a rizikem vzniku Alzheimerovy choroby.[8]


Dopenezil, jedno z léčiv podávaných pacientům s Alzheimerovou chorobou

Alzheimerova choroba je v současnosti nevyléčitelná a používaná léčiva přináší pacientům jen poměrně nízký prospěch.[9][10] Tzv. inhibitory acetylcholinesterázy (tacrin, rivastigmin, galantamin a donepezil) snižují degradaci acetylcholinu, což vyrovnává ztrátu acetylcholinu způsobenou degenerací cholinergních center v mozku.[11][12] Dalším používaným léčivem je memantin ze skupiny inhibitorů NMDA receptorů.[13][10] Medikace je spíše doplňována psychosociální podporou pacientů a péčí o nemocné.


Choroba zpravidla není diagnostikována zcela v začátcích a po diagnóze je střední délka dožití 6 let.[14] Méně než 3 % pacientů žijí po diagnóze déle než 14 let.

[15] Nemoci podlehne 68 % pacientů, kteří s ní byli diagnostikováni;[14] příčinou úmrtí nejsou zpravidla přímé dopady neurodegenerace mozku, ale i nepřímé dopady nemoci, jako je nižší odolnost vůči infekcím (pneumonie), krevní sraženiny způsobené dlouhým pobytem na lůžku nebo potíže s příjmem potravy.[16][17][18]


Dle studie z roku 2000 trpělo Alzheimerovou chorobou 1,6 % populace Spojených států (ve věkové skupině 64–74 let také 1,6 %, ve věkové skupině 75–84 let 19 % a ve skupině nad 84 let až 42 % populace).[19] V rozvojových zemích je onemocnění vzácnější.

[20] Kvůli stárnutí populace počet nemocných s Alzheimerovou chorobou roste.[21] Péče o pacienty je velmi časově i finančně náročná a odhaduje se, že celosvětové náklady na péči o pacienty s demencí v roce 2005 činily více než 300 miliard amerických dolarů (>7 bilionů korun), tedy více než činí např.

náklady na zdravotní potíže související s kouřením nebo s cukrovkou.[21]



V tomto článku byl použit překlad textu z článku Alzheimer's disease na anglické Wikipedii.

  1. Gale Encyclopedia of Medicine. Příprava vydání Fundukian, LJ.. 4. vyd. [s.l.]: Gale, 2011. ISBN 978-1-4144-8646-8. S. 167–181. 
  2. ↑ a b BUDSON, Andrew E.; SOLOMON, Paul R. Memory Loss, Alzheimer’s Disease, and Dementia: A Practical Guide for Clinicians. 2. vyd. [s.l.]: Elsevier, 2016. ISBN 978-0-323-28661-9. 
  3. ↑ a b c d CREWS, L., Masliah, E. Molecular mechanisms of neurodegeneration in Alzheimer's disease. Human Molecular Genetics. 2010-04-22, roč. 19, čís. R1, s. R12–R20. DOI:10.1093/hmg/ddq160. 
  4. ↑ KAWAS, Claudia H. Medications and diet: protective factors for AD?. Alzheimer Disease and Associated Disorders. 2006-09-01, roč. 20, čís. 3 Suppl 2, s. S89–96. PMID: 16917203 PMCID: PMC3373253. Dostupné online [cit. 2016-07-03]. ISSN 0893-0341. PMID 16917203. 
  5. ↑ LUCHSINGER, José A.; MAYEUX, Richard. Dietary factors and Alzheimer's disease. The Lancet. Neurology. 2004-10-01, roč. 3, čís. 10, s. 579–587. PMID: 15380154. Dostupné online [cit. 2016-07-03]. ISSN 1474-4422. DOI:10.1016/S1474-4422(04)00878-6. PMID 15380154. 
  6. ↑ LUCHSINGER, José A.; NOBLE, James M.; SCARMEAS, Nikolaos. Diet and Alzheimer's disease. Current Neurology and Neuroscience Reports. 2007-09-01, roč. 7, čís. 5, s. 366–372. PMID: 17764625. Dostupné online [cit. 2016-07-03]. ISSN 1528-4042. PMID 17764625. 
  7. Independent Panel Finds Insufficient Evidence to Support Preventive Measures for Alzheimer’s Disease [online]. 2015-08-14 [cit. 2016-07-03]. Dostupné online. 
  8. ↑ SZEKELY, C. A.; BREITNER, J. C. S.; ZANDI, P. P. Prevention of Alzheimer's disease. International Review of Psychiatry (Abingdon, England). 2007-12-01, roč. 19, čís. 6, s. 693–706. PMID: 18092245. Dostupné online [cit. 2016-07-03]. ISSN 1369-1627. DOI:10.1080/09540260701797944. PMID 18092245. 
  9. ↑ BIRKS, J.; HARVEY, R. J. Donepezil for dementia due to Alzheimer's disease. The Cochrane Database of Systematic Reviews. 2006-01-01, čís. 1, s. CD001190. PMID: 16437430. Dostupné online [cit. 2016-07-03]. ISSN 1469-493X. DOI:10.1002/14651858.CD001190.pub2. PMID 16437430. 
  10. ↑ a b Drugs for Alzheimer's disease: best avoided. No therapeutic advantage. Prescrire International. 2012-06-01, roč. 21, čís. 128, s. 150. PMID: 22822592. Dostupné online [cit. 2016-07-03]. ISSN 1167-7422. PMID 22822592. 
  11. ↑ POHANKA, Miroslav. Cholinesterases, a target of pharmacology and toxicology. Biomedical Papers of the Medical Faculty of the University Palacký, Olomouc, Czechoslovakia. 2011-09-01, roč. 155, čís. 3, s. 219–229. PMID: 22286807. Dostupné online [cit. 2016-07-03]. ISSN 1213-8118. PMID 22286807. 
  12. ↑ STAHL, S. M. The new cholinesterase inhibitors for Alzheimer's disease, Part 2: illustrating their mechanisms of action. The Journal of Clinical Psychiatry. 2000-11-01, roč. 61, čís. 11, s. 813–814. PMID: 11105732. Dostupné online [cit. 2016-07-03]. ISSN 0160-6689. PMID 11105732. 
  13. ↑ MCSHANE, R.; AREOSA SASTRE, A.; MINAKARAN, N. Memantine for dementia. The Cochrane Database of Systematic Reviews. 2006-01-01, čís. 2, s. CD003154. PMID: 16625572. Dostupné online [cit. 2016-07-03]. ISSN 1469-493X. DOI:10.1002/14651858.CD003154.pub5. PMID 16625572. 
  14. ↑ a b MÖLSÄ, P.k.; MARTTILA, R.j.; RINNE, U.k. Survival and cause of death in Alzheimer's disease and multi-infarct dementia. Acta Neurologica Scandinavica. 1986-08-01, roč. 74, čís. 2, s. 103–107. Dostupné online [cit. 2016-07-03]. ISSN 1600-0404. DOI:10.1111/j.1600-0404.1986.tb04634.x. (anglicky) 
  15. ↑ MÖLSÄ, P. K.; MARTTILA, R. J.; RINNE, U. K. Long-term survival and predictors of mortality in Alzheimer's disease and multi-infarct dementia. Acta Neurologica Scandinavica. 1995-03-01, roč. 91, čís. 3, s. 159–164. Dostupné online [cit. 2016-07-03]. ISSN 1600-0404. DOI:10.1111/j.1600-0404.1995.tb00426.x. (anglicky) 
  16. ↑ Study: Alzheimer’s Disease a Much Larger Cause of Death Than Reported. [online]. [cit. 2016-07-03]. Dostupné v archivu pořízeném dne 2016-08-29. 
  17. The later stages of dementia [online]. Alzheimer's Society [cit. 2016-07-03]. Dostupné online. 
  18. 'Car Talk' Host's Death: How Does Alzheimer's Disease Kill? [online]. [cit. 2016-07-03]. Dostupné online. 
  19. ↑ HEBERT, Liesi E.; SCHERR, Paul A.; BIENIAS, Julia L. Alzheimer disease in the US population: prevalence estimates using the 2000 census. Archives of Neurology. 2003-08-01, roč. 60, čís. 8, s. 1119–1122. PMID: 12925369. Dostupné online [cit. 2016-07-03]. ISSN 0003-9942. DOI:10.1001/archneur.60.8.1119. PMID 12925369. 
  20. ↑ FERRI, Cleusa P.; PRINCE, Martin; BRAYNE, Carol. Global prevalence of dementia: a Delphi consensus study. Lancet (London, England). 2005-12-17, roč. 366, čís. 9503, s. 2112–2117. PMID: 16360788 PMCID: PMC2850264. Dostupné online [cit. 2016-07-03]. ISSN 1474-547X. DOI:10.1016/S0140-6736(05)67889-0. PMID 16360788. 
  21. ↑ a b QIU, Chengxuan; KIVIPELTO, Miia; VON STRAUSS, Eva. Epidemiology of Alzheimer's disease: occurrence, determinants, and strategies toward intervention. Dialogues in Clinical Neuroscience. 2009-01-01, roč. 11, čís. 2, s. 111–128. PMID: 19585947 PMCID: PMC3181909. Dostupné online [cit. 2016-07-03]. ISSN 1294-8322. PMID 19585947. 

Externí odkazy

  • Obrázky, zvuky či videa k tématu Alzheimerova choroba ve Wikimedia Commons
  • (česky) Česká alzheimerovská společnost
  • (česky) Alzheimercentrum
  • (anglicky) Alzheimerova choroba v databázi Who Named It?

Wikipedie neručí za správnost žádných informací v žádném článku. V případě potřeby vyhledejte odpovídajícího odborníka!Přečtěte si prosím pokyny pro využití článků o zdravotnictví.Portály: Medicína Autoritní data: AUT: ph117324 | GND: 4112510-1 | LCCN: sh85004080 | WorldcatID: lccn-sh85004080Citováno z „“



Vaše e-mailová adresa nebude zveřejněna. Vyžadované informace jsou označeny *